Invitrogen™ Human TTC21B (aa 336-427) Control Fragment Recombinant Protein

Product Code. 30205762

Brand: Invitrogen™ RP109336

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140036 (PA5-140036. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The tetratricopeptide repeat (TPR) motif is a degenerate, 34 amino acid sequence found in many proteins and acts to mediate protein-protein interactions in various pathways. At the sequence level, there can be up to 16 tandem TPR repeats, each of which has a helix-turn-helix shape that stacks on other TPR repeats to achieve ligand binding specificity. TTC21B (tetratricopeptide repeat domain 21B), also known as THM1, is a 1,316 amino acid protein that contains 19 TPR repeats and belongs to the TTC21 family. Localizing to cytoplasm and cytoskeleton, TTC21B exists as two alternatively spliced isoforms and is thought to negatively regulate Shh signal transduction. TTC21B may also be involved in retrograde intraflagellar transport in cilia, and is encoded by a gene that maps to human chromosome 2q24.3.

Specifications

• Accession Number: Q7Z4L5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79809
• Name: Human TTC21B (aa 336-427) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410066K11Rik; aln; ATD4; IFT139; IFT139B; Intraflagellar transport 139 homolog; JBTS11; Kiaa1992; line 158; mKIAA1992; Nbla10696; NPHP12; putative protein product of Nbla10696; RGD1565122; SRTD4; tetratricopeptide repeat domain 21 B; tetratricopeptide repeat protein 21 B; Tetratricopeptide repeat-containing hedgehog modulator 1; Thm1; TPR repeat protein 21 B; Ttc21b
• Common Name: TTC21B
• Gene Symbol: TTC21B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining