Invitrogen™ Human TTBK1 (aa 1091-1172) Control Fragment Recombinant Protein

Product Code. 30193883

Brand: Invitrogen™ RP94885

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56840 (PA5-56840. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TTBK1 is a member of the casein kinase 1 superfamily, and it functions as a neuron-specific serine/threonine and tyrosine kinase. Its primary role is to regulate the phosphorylation of tau, a protein that stabilizes microtubule assemblies. It has been found that genetic variants in this gene are linked to Alzheimer's disease. Additionally, TTBK1 is associated with several other diseases, including Childhood-Onset Schizophrenia and Spinocerebellar Ataxia 11.

Specifications

• Accession Number: Q5TCY1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84630
• Name: Human TTBK1 (aa 1091-1172) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU017937; AW048023; BDTK; Brain-derived tau kinase; C330008L01Rik; KIAA1855; RP3-330M21.4; tau tubulin kinase 1; tau-tubulin kinase 1; Ttbk1
• Common Name: TTBK1
• Gene Symbol: TTBK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining