Invitrogen™ Human TST (aa 159-294) Control Fragment Recombinant Protein

Product Code. 30194142

Brand: Invitrogen™ RP91513

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82055 (PA5-82055. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Specifications

• Accession Number: Q16762
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7263
• Name: Human TST (aa 159-294) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: LL22NC01-146D10.3; MGC19578; RDS; RHODAN; Rhodanese; thiosulfate sulfurtransferase; thiosulfate sulfurtransferase (rhodanese); thiosulfate sulfurtransferase, mitochondrial; Thiosulfate sulphurtransferase (rhodanese); TST
• Common Name: TST
• Gene Symbol: TST
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining