Invitrogen™ Human TSSC1 (aa 8-89) Control Fragment Recombinant Protein

Product Code. 30205276

Brand: Invitrogen™ RP95958

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56685 (PA5-56685. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSSC1 has been reported in PMID 9403053 as one of several tumor-suppressing sub transferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alignment of this gene to genomic sequence data suggests that this gene resides on chromosome 2 rather than chromosome 11.

Specifications

• Accession Number: Q53HC9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7260
• Name: Human TSSC1 (aa 8-89) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EARP and GARP complex-interacting protein 1; EIPR1; Endosome-associated recycling protein-interacting protein; Golgi-associated retrograde protein-interacting protein; protein TSSC1; Tssc1; tumor suppressing subtransferable candidate 1; tumor-suppressing STF cDNA 1 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein
• Common Name: TSSC1
• Gene Symbol: EIPR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IYGLEFQARALTPQTAETDAIRFLVGTQSLKYDNQIHIIDFDDENNIINKNVLLHQAGEIWHISASPADRGVLTTCYNRTSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining