Invitrogen™ Human TSPYL5 (aa 268-389) Control Fragment Recombinant Protein

Product Code. 30208941

Brand: Invitrogen™ RP88800

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56710 (PA5-56710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in modulation of cell growth and cellular response to gamma radiation probably via regulation of the Akt signaling pathway. Involved in regulation of p53/TP53. Suppresses p53/TP53 protein levels and promotes its ubiquitination; the function is dependent on USP7 and independent on MDM2. Proposed to displace p53/TP53 from interaction with USP7.

Specifications

• Accession Number: Q86VY4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85453
• Name: Human TSPYL5 (aa 268-389) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330530B20; E130308C19Rik; Kiaa1750; testis-specific protein, Y-encoded-like 5; testis-specific Y-encoded-like protein 5; TSPY like 5; TSPYL5; TSPY-like 5; TSPY-like protein 5
• Common Name: TSPYL5
• Gene Symbol: TSPYL5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQEKEVLSYLNSLEVEELGLARLGYKIKFYFDRNPYFQNKVLIKEYGCGPSGQVVSRSTPIQWLPGHDLQSLSQGNPENNRSFFGWFSNHSSIESDKIVEIINEELWPNPLQFYLLSEGARV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining