Invitrogen™ Human TSPYL2 (aa 390-527) Control Fragment Recombinant Protein

Product Code. 30200805

Brand: Invitrogen™ RP92259

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111195 (PA5-111195. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the beta-subunit of glucosidase II, an N-linked glycan-processing enzyme in the endoplasmic reticulum (ER). This protein is an acidic phospho-protein known to be a substrate for protein kinase C. Mutations in this gene have been associated with the autosomal dominant polycystic liver disease (PCLD). Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Specifications

• Accession Number: Q9H2G4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64061
• Name: Human TSPYL2 (aa 390-527) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CASK interacting nucleosome assembly protein; CASK-interacting nucleosome assembly protein; CDA1; Cell division autoantigen 1; cell division autoantigen 1 nucleolar protein; CINAP; CTCL; CTCL tumor antigen se20-4; CTCL-associated antigen se20-4; Cutaneous T-cell lymphoma-associated antigen se20-4; cutaneous T-cell lymphoma-associated tumor antigen se20-4; DENTT; differentially expressed nucleolar TGF-beta1 target; differentially-expressed nucleolar TGF-beta1 target protein; DXBwg1396e; DXHXS1008E; E130307F10Rik; HRIHFB2216; NP79; nuclear protein of 79 kDa; nucleolar TGF-beta1 target protein; RGD1563283; RP1-290F12.2; SE204; testis-specific protein Y encoded-like 2; testis-specific Y-encoded-like protein 2; TSPX; TSPY like 2; Tspyl2; TSPY-like 2; TSPY-like protein 2
• Common Name: TSPYL2
• Gene Symbol: TSPYL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining