Invitrogen™ Human TSPAN2 (aa 115-187) Control Fragment Recombinant Protein

Product Code. 30206656

Brand: Invitrogen™ RP90762

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53355 (PA5-53355. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSPAN2 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Specifications

• Accession Number: O60636
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10100
• Name: Human TSPAN2 (aa 115-187) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330415F13Rik; B230119D02Rik; NET3; new EST tetraspan 3; tetraspan 2; tetraspan NET-3; tetraspan TM4SF; tetraspanin 2; tetraspanin 2 isoform; tetraspanin-2; TSN2; TSPAN2; TSPAN-2
• Common Name: TSPAN2
• Gene Symbol: TSPAN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining