Invitrogen™ Human TSPAN17 (aa 162-231) Control Fragment Recombinant Protein

Product Code. 30209961

Brand: Invitrogen™ RP105829

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65066 (PA5-65066. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates ADAM10 maturation.

Specifications

• Accession Number: Q96FV3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26262
• Name: Human TSPAN17 (aa 162-231) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210021G21Rik; AI047581; F-box only protein 23; F-box only protein 23, transmembrane 4 superfamily member 17; FB x 23; Fbxo23; fc49c03; gamma-hydroxybutyrate receptor; GHB-R; tetraspan protein SB134; tetraspanin 17; tetraspanin-17; TM4SF17; transmembrane 4 superfamily member 17; transmembrane 4 superfamily member 17 isoform b; TSPAN17; tspan-17; wu:fc49c03; zgc:158284
• Common Name: TSPAN17
• Gene Symbol: Tspan17
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining