Invitrogen™ Human TSPAN15 (aa 258-294) Control Fragment Recombinant Protein

Product Code. 30210453

Brand: Invitrogen™ RP109252

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139906 (PA5-139906. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSPAN15 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.

Specifications

• Accession Number: O95858
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23555
• Name: Human TSPAN15 (aa 258-294) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110036D12Rik; 2700063A19Rik; AW048364; NET7; NET-7; Tetraspan NET-7; tetraspanin 15; tetraspanin-15; TM4SF15; transmembrane 4 superfamily member 15; transmembrane 4 superfamily member tetraspan NET-7; Tspan15; tspan-15; UNQ677/PRO1311
• Common Name: TSPAN15
• Gene Symbol: TSPAN15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining