Invitrogen™ Human TSHZ3 (aa 26-108) Control Fragment Recombinant Protein

Product Code. 30207266

Brand: Invitrogen™ RP109234

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Teashirt zinc finger homeobox (TSHZ) family comprise a family of evolutionarily conserved transcription factors that, in Drosophila, are active in specific body parts for patterning, but whose function in vertebrates is less clear. In mice, the known three TSHZ proteins are expressed in distinct patterns in the developing and adult brain, suggesting that they play a role in the establishment of regional identity and specification of cell types within the brain. Both TSHZ3 and TSHZ1 have been found to interact with FE65, an adapter protein that binds to the amyloid protein precursor (APP) in neurons. Together with SET, a component of the inhibitor of acetyl transferase, and histone deacetylases, these proteins formed a gene-silencing complex whose target includes caspase-4. Recent experiments have also suggested this family of proteins may be involved in carcinogenesis.

Specifications

• Accession Number: Q63HK5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57616
• Name: Human TSHZ3 (aa 26-108) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A630038G13Rik; Kiaa1474; mKIAA1474; teashirt 3; teashirt homolog 3; teashirt zinc finger family member 3; teashirt zinc finger homeobox 3; teashirt3; Tsh3; Tshz3; Zfp537; zinc finger protein 537; ZNF537
• Common Name: TSHZ3
• Gene Symbol: Tshz3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQNSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETKEVTVPLED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining