missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TSHZ3 (aa 26-108) Control Fragment Recombinant Protein

Product Code. 30207266
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207266

Brand: Invitrogen™ RP109234

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Teashirt zinc finger homeobox (TSHZ) family comprise a family of evolutionarily conserved transcription factors that, in Drosophila, are active in specific body parts for patterning, but whose function in vertebrates is less clear. In mice, the known three TSHZ proteins are expressed in distinct patterns in the developing and adult brain, suggesting that they play a role in the establishment of regional identity and specification of cell types within the brain. Both TSHZ3 and TSHZ1 have been found to interact with FE65, an adapter protein that binds to the amyloid protein precursor (APP) in neurons. Together with SET, a component of the inhibitor of acetyl transferase, and histone deacetylases, these proteins formed a gene-silencing complex whose target includes caspase-4. Recent experiments have also suggested this family of proteins may be involved in carcinogenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q63HK5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57616
Name Human TSHZ3 (aa 26-108) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A630038G13Rik; Kiaa1474; mKIAA1474; teashirt 3; teashirt homolog 3; teashirt zinc finger family member 3; teashirt zinc finger homeobox 3; teashirt3; Tsh3; Tshz3; Zfp537; zinc finger protein 537; ZNF537
Common Name TSHZ3
Gene Symbol Tshz3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VDEGLDPEEHTADGEPSAKYMCPEKELARACPSYQNSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETKEVTVPLED
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.