Invitrogen™ Human TSEN2 (aa 93-189) Control Fragment Recombinant Protein

Product Code. 30205268

Brand: Invitrogen™ RP94795

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55513 (PA5-55513. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. Isoform 1 probably carries the active site for 5'-splice site cleavage. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre- mRNA 3'-end processing factors, establishing a link between pre- tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events. Isoform 2 is responsible for processing a yet unknown RNA substrate. The complex containing isoform 2 is not able to cleave pre-tRNAs properly, although it retains endonucleolytic activity.

Specifications

• Accession Number: Q8NCE0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80746
• Name: Human TSEN2 (aa 93-189) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU067695; HsSen2; PCH2B; RGD1309946; SEN2; SEN2L; tRNA splicing endonuclease 2 homolog (S. cerevisiae); tRNA splicing endonuclease subunit 2; tRNA-intron endonuclease Sen2; tRNA-intron nuclease 2; tRNA-splicing endonuclease subunit Sen2; Tsen2; TSEN2 tRNA splicing endonuclease subunit
• Common Name: TSEN2
• Gene Symbol: Tsen2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KTNMPIITSKRYQHSVEWAAELMRRQGQDESTVRRILKDYTKPLEHPPVKRNEEAQVHDKLNSGMVSNMEGTAGGERPSVVNGDSGKSGGVGDPREP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining