Invitrogen™ Human Trypsin (aa 68-97) Control Fragment Recombinant Protein

Product Code. 30211222

Brand: Invitrogen™ RP104539

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111565 (PA5-111565. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Trypsin is a 24 kDa enzyme of the serine proteinase family. It is produced in the pancreas as an inactive precursor, trypsinogen, but the active enzyme is located in the gastrointestinal tract where it degrades proteins to large peptides. Trypsin prefers lysine and arginine residues. One of the substrates for trypsin is chymotrypsinogen which is cleaved to produce active chymotrypsin. High levels of immunoreactive trypsin in the bloodstream can indicate pancreatic malfunction and this indicator is used to screene for and diagnose Cystic Fibrosis.

Specifications

• Accession Number: P07477
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5644
• Name: Human Trypsin (aa 68-97) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Alpha-trypsin chain 1; Alpha-trypsin chain 2; Anionic trypsin I; anionic trypsin-1; Anionic trypsinogen; beta-trypsin; Cationic trypsinogen; digestive zymogen; MGC120175; MGC149362; nonfunctional trypsin 1; pancreatic trypsin 1; pretrypsinogen I; Protease Serine 1; protease serine 2 preproprotein; protease, serine 1; protease, serine 1 (trypsin 1); protease, serine 2; protease, serine, 1; protease, serine, 1 (trypsin 1); protease, serine, 2; protease, serine, 2 (trypsin 2); PRSS1; PRSS2; PTRYI; RATPTRYI; Serine protease 1; Serine protease 2; TCR V beta 4.1; TRP1; Try1; Try-1; TRY2; TRY4; TRY8; Trygn16; TRYP1; TRYP2; TRYP8; trypsin 1; Trypsin I; Trypsin II; trypsin-1; Trypsin-2; trypsinogen; trypsinogen 1; trypsinogen 16; trypsinogen 2; trypsinogen A
• Common Name: Trypsin
• Gene Symbol: PRSS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RIQVRLGEHNIEVLEGNEQFINAAKIIRHP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining