Invitrogen™ Human TRPV2 (aa 27-108) Control Fragment Recombinant Protein

Product Code. 30181431

Brand: Invitrogen™ RP99981

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VLR-1 is a calcium-permeable, non-selective cation channel with an outward rectification, that seems to be regulated, at least in part, by growth factors, like IGF1, PDGF and morphogenetic neuropeptide/head activator. VRL-1 does not respond to capsaicin, acid, or moderate heat, but instead is activated by high temperatures, with a threshold of approximately 52 degrees C. Within sensory ganglia, VRL-1 is most prominently expressed by a subset of medium- to large-diameter neurons, making it a candidate receptor for transducing high-threshold heat responses in this class of cells. VRL-1 transcripts are not restricted to the sensory nervous system, indicating that this channel may be activated by stimuli other than heat. VRL-1 is one of the six members of the vanilloid-like TRP-channel family which is now known as TRPV family.

Specifications

• Accession Number: Q9Y5S1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51393
• Name: Human TRPV2 (aa 27-108) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: GRC; growth factor regulated channel; growth factor-regulated calcium channel; Osm-9-like TRP channel 2; OTRPC2; RP23-234K24.7; Sac2b; Stretch-activated channel 2 B; transient receptor potential cation channel subfamily V member 2; transient receptor potential cation channel, subfamily V, member 2; Trpv2; Vanilloid receptor-like protein 1; VRL; Vrl1; VRL-1
• Common Name: TRPV2
• Gene Symbol: Trpv2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining