Invitrogen™ Human TRPT1 (aa 110-184) Control Fragment Recombinant Protein

Product Code. 30203142

Brand: Invitrogen™ RP97387

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58503 (PA5-58503. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRPT1 catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1'-2' cyclic phosphate. It has four isoforms with MW 22-24 and 27-29 kDa.

Specifications

• Accession Number: Q86TN4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83707
• Name: Human TRPT1 (aa 110-184) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU079016; AW045591; EST-MNCb3719; mTPT1; Tpt1; Tpt1h; tRNA 2'-phosphotransferase 1; tRNA phosphotransferase 1; tRNA splicing 2' phosphotransferase 1; tRNA splicing 2' phosphotransferase 1 homolog; TRPT1
• Common Name: TRPT1
• Gene Symbol: Trpt1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPKLELMPLETPQALPPMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRSHCEIAVFIDGPLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining