Invitrogen™ Human TRPML3 (aa 146-244) Control Fragment Recombinant Protein

Product Code. 30198777

Brand: Invitrogen™ RP91207

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53725 (PA5-53725. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Expressed in the cochlea; particularly in the inner and outer hair cells. Defects in Mcoln3 are the cause of the varitin-waddler (Va) phenotype. Classical Va mice exhibit early-onset hearing loss, vestibular defects, pigmentation abnormalities and perinatal lethality. The phenotype varitin-waddler Jackcon (Va-J), which arose in a cross segregating for Va, is similar but less severe. Belongs to the transient receptor family, polycystin subfamily.

Specifications

• Accession Number: Q8TDD5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55283
• Name: Human TRPML3 (aa 146-244) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6720490O21Rik; FLJ11006; FLJ36629; MCLN3; Mcoln3; Mcoln3 mucolipin 3; MGC124245; MGC124246; MGC71509; mucolipin 3; mucolipin-3; Transient receptor potential channel mucolipin 3; TRPML3; TRP-ML3; Va; varitint-waddler
• Common Name: TRPML3
• Gene Symbol: MCOLN3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining