missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210420

Invitrogen™ Human TROVE2 (aa 371-506) Control Fragment Recombinant Protein

Product Code. 30210420
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210420

Brand: Invitrogen™ RP101875

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-110661 (PA5-110661, PA5-64899 (PA5-64899. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TROVE2 belongs to the Ro 60 kDa family. It is RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P10155
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6738
Name Human TROVE2 (aa 371-506) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810007I17Rik; 60 kDa ribonucleoprotein Ro; 60 kDa Ro protein; 60 kDa SS-A/Ro ribonucleoprotein; 60 kDa SS-A/Ro ribonucleoprotein-like protein; A530054J02Rik; AI646302; gastric cancer multi-drug resistance protein; LOW QUALITY PROTEIN: 60 kDa SS-A/Ro ribonucleoprotein; Ro 60 kDa autoantigen; RO60; Ro60 autoantigen; Ro60, Y RNA binding protein; roRNP; RP11-101E13.3; Sjoegren syndrome antigen A2; Sjoegren syndrome type A antigen; Sjogren syndrome antigen A2; Sjogren syndrome antigen A2 (60 kD, ribonucleoprotein autoantigen SS-A/Ro); Ssa; SS-A; SS-A/Ro; SSA2; TROVE domain family member 2; TROVE domain family, member 2; Trove2
Common Name TROVE2
Gene Symbol RO60
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.