missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210986

Invitrogen™ Human TROP2 Control Fragment Recombinant Protein

Product Code. 30210986
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210986

Brand: Invitrogen™ RP104102

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84235 (PA5-84235. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TROP2 is a carcinoma-associated antigen defined by the monoclonal antibody GA733. This antigen is a member of a family including at least two type I membrane proteins. It transduces an intracellular calcium signal and acts as a cell surface receptor. Mutations of its gene result in gelatinous drop-like corneal dystrophy, an autosomal recessive disorder characterized by severe corneal amyloidosis leading to blindness.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P09758
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4070
Name Human TROP2 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 40 kD glycoprotein, identified by monoclonal antibody GA733; C80403; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; EGP1; EGP-1; epithelial glycoprotein-1; GA733; GA7331; GA733-1; gastrointestinal tumor-associated antigen GA7331; GP50; Ly97; lymphocyte antigen 97; M1S1; Membrane component chromosome 1 surface marker 1; membrane component, chromosome 1, surface marker 1; pancreatic carcinoma marker protein GA7331; pancreatic carcinoma marker protein GA733-1; parturition-related protein 1; Prp1; TACD2; TACSTD2; Trop2; truncated TACSTD2; tumor-associated calcium signal transducer 2; tunor-associated calcium signal transducer 2
Common Name TROP2
Gene Symbol TACSTD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGEVDIGDAAYYFERDIKGESL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.