Invitrogen™ Human TRMT6 (aa 114-201) Control Fragment Recombinant Protein

Product Code. 30194498

Brand: Invitrogen™ RP106283

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65616 (PA5-65616. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Substrate-binding subunit of tRNA (adenine-N(1)-)-methyltransferase, which catalyzes the formation of N(1)-methyladenine at position 58 (m1A58) in initiator methionyl-tRNA.

Specifications

• Accession Number: Q9UJA5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51605
• Name: Human TRMT6 (aa 114-201) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3300001M20Rik; AU016412; AW492787; CGI-09; GCD10; Gcd10p; Kiaa1153; MGC5029; mKIAA1153; mRNA methyladenosine-N(1)-methyltransferase non-catalytic subunit TRM6; RGD1308877; Trm6; TRMT6; tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6; tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit TRM6; tRNA methyltransferase 6; tRNA methyltransferase 6 homolog; tRNA(m1A58)-methyltransferase subunit TRM6; tRNA(m1A58)MTase subunit TRM6
• Common Name: TRMT6
• Gene Symbol: TRMT6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKDKGIKGEEIVQQLIENSTTFRDKTEFAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAGN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining