Invitrogen™ Human TRMT11 (aa 149-228) Control Fragment Recombinant Protein

Artikelnummer. 30201234

Marke: Invitrogen™ RP105830

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (%), Rat (%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65067 (PA5-65067. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.

Spezifikation

• Accession Number: Q7Z4G4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 60487
• Name: Human TRMT11 (aa 149-228) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410075D05Rik; 3110045I18Rik; AW213713; C6orf75; MDS024; putative RNA methylase MDS024; TRM11; Trmt11; TRMT11-1; tRNA (guanine(10)-N2)-methyltransferase homolog; tRNA guanosine-2'-O-methyltransferase TRM11 homolog; tRNA guanosine-2'-O-methyltransferase TRM11-like protein-like protein; tRNA methyltransferase 11; tRNA methyltransferase 11 homolog; tRNA methyltransferase 11 homolog (S. cerevisiae)
• Common Name: TRMT11
• Gene Symbol: TRMT11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining