Invitrogen™ Human TRMT1 (aa 469-542) Control Fragment Recombinant Protein

Product Code. 30180988

Brand: Invitrogen™ RP98374

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59543 (PA5-59543. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRMT1 is a tRNA(m(2)(2)G(26))dimethyltransferase.

Specifications

• Accession Number: Q9NXH9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55621
• Name: Human TRMT1 (aa 469-542) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6720406L13Rik; 6720477L24; D8Ertd812e; FLJ20244; im:7150454; LOC553298 protein; n(2),N(2)-dimethylguanosine tRNA methyltransferase; N(2),N(2)-dimethylguanosine tRNA methyltransferase; tRNA (guanine(26)-N(2))-dimethyltransferase; RGD1305992; TRM1; TRM1 tRNA methyltransferase 1; TRM1 tRNA methyltransferase 1 homolog; TRMT1; tRNA (guanine(26)-N(2))-dimethyltransferase; tRNA 2,2-dimethylguanosine-26 methyltransferase; tRNA methyltransferase 1; tRNA methyltransferase 1 homolog; tRNA methyltransferase 1 homolog (S. cerevisiae); tRNA(guanine-26,N(2)-N(2)) methyltransferase; tRNA(m(2,2)G26)dimethyltransferase
• Common Name: TRMT1
• Gene Symbol: TRMT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining