Invitrogen™ Human TRIP15 (aa 341-443) Control Fragment Recombinant Protein

Product Code. 30196004

Brand: Invitrogen™ RP91687

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110835 (PA5-110835. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Specifications

• Accession Number: P61201
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9318
• Name: Human TRIP15 (aa 341-443) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI315723; ALIEN; alien homolog; Alien protein; alien-like; alien-PA; alien-PB; alien-PD; alien-PE; BcDNA:LD10463; beta-casein; C85265; CASB; casein beta; CG9556; CG9556-PA; CG9556-PB; CG9556-PD; CG9556-PE; CH2; COP9; COP9 (constitutive photomorphogenic) homolog, subunit 2; COP9 (constitutive photomorphogenic) homolog, subunit 2 (Arabidopsis thaliana); COP9 complex homolog subunit 2; COP9 constitutive photomorphogenic homolog subunit 2; COP9 signalosome complex subunit 2; COP9 signalosome subunit 2; COP9 signalosome subunit 2 CSN2; COPS2; Csn2; Csnb; d-Alien; DCH2; Dmel\CG9556; Dmel_CG9556; drosophila COP9 signalosome homolog 2; JAB1-containing signalosome subunit 2; SD08021p; SGN2; signalosome subunit 2; thyroid receptor interacting protein 15; thyroid receptor-interacting protein 15; TR-interacting protein 15; TRIP15; TRIP-15; tyroid receptor interacting protein 15
• Common Name: TRIP15
• Gene Symbol: COPS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining