Invitrogen™ Human TRIP13 (aa 31-148) Control Fragment Recombinant Protein

Product Code. 30210993

Brand: Invitrogen™ RP89294

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52193 (PA5-52193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Thyroid hormone receptors (TRs) are transcription factors that regulate the expression of specific genes in a hormone-dependent manner. TRIP13 (thyroid hormone receptor interactor 13), also called 16E1BP, is a transcription factor that interacts with the ligand binding domain of the thyroid receptor (TR) as well as a variety of target genes including human papilloma virus type 16 (HPV16) E1. Unlike most TRIP proteins which function only in the presence of hormones, TRIP13 does not require the presence of thyroid hormone to interact with TR. The association of TRIP13 with (HPV16) E1 suggests that TRIP13 may have tumor suppressor gene function. TRIP13 is a 432 amino acid protein with 2 different isoforms produced by alternative splicing.

Specifications

• Accession Number: Q15645
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9319
• Name: Human TRIP13 (aa 31-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 16E1BP; 16E1-BP; 2410002G23Rik; D13Ertd328e; HPV16 E1 protein binding protein; HPV16 E1 protein-binding protein; human papillomavirus type 16 E1 protein-binding protein; Pachytene checkpoint protein 2 homolog; PCH2; Thyroid hormone receptor interactor 13; thyroid receptor interacting protein 13; thyroid receptor-interacting protein 13; TR-interacting protein 13; TRIP13; TRIP-13
• Common Name: TRIP13
• Gene Symbol: TRIP13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLVYDVEVKSH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining