Invitrogen™ Human TRIM60 (aa 356-414) Control Fragment Recombinant Protein

Product Code. 30210056

Brand: Invitrogen™ RP103830

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63967 (PA5-63967. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Pseudogenes of this gene are located on more than six chromosomes including chromosome 4. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2013].

Specifications

• Accession Number: Q495X7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 166655
• Name: Human TRIM60 (aa 356-414) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2 czf45; RING finger protein 129; ring finger protein 33; RNF129; Rnf33; TRIM60; tripartite motif containing 60; tripartite motif-containing 60; tripartite motif-containing protein 60
• Common Name: TRIM60
• Gene Symbol: TRIM60
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGNKPKWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining