Invitrogen™ Human TRIM47 (aa 504-610) Control Fragment Recombinant Protein

Product Code. 30194602

Brand: Invitrogen™ RP90757

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53258 (PA5-53258. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E3 ubiquitin-protein ligase that mediates the ubiquitination and proteasomal degradation of CYLD. [UniProt]

Specifications

• Accession Number: Q96LD4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91107
• Name: Human TRIM47 (aa 504-610) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210023F24Rik; E3 ubiquitin-protein ligase TRIM47; Gene overexpressed in astrocytoma protein; GOA; RING finger protein 100; RNF100; Trim47; tripartite motif containing 47; tripartite motif protein 47; tripartite motif-containing 47; tripartite motif-containing protein 47
• Common Name: TRIM47
• Gene Symbol: TRIM47
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining