Invitrogen™ Human TRIM45 (aa 200-278) Control Fragment Recombinant Protein

Product Code. 30211641

Brand: Invitrogen™ RP94211

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56420 (PA5-56420. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described. TRIM45 belongs to a family of tripartite motif (TRIM) proteins that play important roles in a variety of cellular functions, including cell proliferation, differentiation, development, oncogenesis, and apoptosis.

Specifications

• Accession Number: Q9H8W5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80263
• Name: Human TRIM45 (aa 200-278) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921530N01Rik; FLJ13181; RING finger protein 99; RNF99; TRIM45; tripartite motif containing 45; tripartite motif protein 45; tripartite motif-containing 45; tripartite motif-containing protein 45
• Common Name: TRIM45
• Gene Symbol: TRIM45
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLFCEFCDRPVCQDCVVGEHREHPCDFTSNVIHKHGDSVWELLKGTQPHVEALEEALAQIHIINSALQKRVEAVAADVR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining