Invitrogen™ Human TRIM40 (aa 176-254) Control Fragment Recombinant Protein

Product Code. 30181912

Brand: Invitrogen™ RP99565

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60525 (PA5-60525. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the tripartite motif (TRIM) protein family. The encoded protein may play a role as a negative regulator against inflammation and carcinogenesis in the gastrointestinal tract. Alternatively spliced transcript variants that encode different protein isoforms have been described.

Specifications

• Accession Number: Q6P9F5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 135644
• Name: Human TRIM40 (aa 176-254) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Probable E3 NEDD8-protein ligase; RING finger protein 35; ring finger RNF35; RNF35; TRIM40; tripartite motif containing 40; tripartite motif protein 40; tripartite motif-containing 40; tripartite motif-containing protein 40
• Common Name: TRIM40
• Gene Symbol: TRIM40
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining