missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205775

Invitrogen™ Human TRIM32 (aa 428-523) Control Fragment Recombinant Protein

Product Code. 30205775
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205775

Brand: Invitrogen™ RP101224

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62127 (PA5-62127. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13049
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22954
Name Human TRIM32 (aa 428-523) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810045E12Rik; 3f3; 72 kDa Tat-interacting protein; BBS11; bM468K2.2 (tripartite motif protein 32); E3 ubiquitin-protein ligase TRIM32; HT2A; LGMD2H; RING-type E3 ubiquitin transferase TRIM32; RP11-67K19.1; TAT-interactive protein, 72-KD; TATIP; Trim32; tripartite motif containing 32; tripartite motif protein 32; tripartite motif-containing 32; tripartite motif-containing protein 32; Zfp117; zinc finger protein 117; zinc finger protein HT2A; zinc-finger protein HT2A
Common Name TRIM32
Gene Symbol Trim32
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.