Invitrogen™ Human TRIM28 (aa 725-810) Control Fragment Recombinant Protein

Product Code. 30209494

Brand: Invitrogen™ RP103540

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The KRAB (Kruppel-associated box) domain is about 45 amino acids in length and is a transcriptional repression domain found in numerous transcription factors. There have been identified over 220 KRAB-zinc finger protein (KRAB-ZFP) genes in the human genome. These proteins functionally repress transcription via specific interactions with KAP-1 (KRAB-associated protein 1). KAP-1 is an 835 amino acid polypeptide that contains a RING finger, B boxes, and a PHD finger. KAP-1 has been shown to form complexes with KRAB-domain transcription factors and increase the efficiency with which they mediate repression. KAP-1 has also been shown to directly interact with HP1 (heterochromatin protein 1) and KRAZ1 (Kruppel-associated box-containing zinc finger protein 1). KAP-1 directly targets KRAZ1 to the foci of centromeric heterochromatin containing HP1alpha, thus helping to regulate transcriptional repression. Studies have shown that KAP-1 mutants with the ability to bind KRAB but unable to bind HP1 leads to random distribution of KRAZ1 and strong transcriptional activation.

Specifications

• Accession Number: Q13263
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10155
• Name: Human TRIM28 (aa 725-810) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA408787; E3 SUMO-protein ligase TRIM28; KAP1; KAP-1; KRAB [Kruppel-associated box domain]-associated protein 1; KRAB-A-interacting protein; KRAB-associated protein 1; KRAB-interacting p; KRAB-interacting protein 1; Krip1; KRIP-1; MommeD9; Nuclear corepressor KAP-1; PPP1R157; protein phosphatase 1, regulatory subunit 157; RING finger protein 96; RING-type E3 ubiquitin transferase TIF1-beta; RNF96; TF1B; tif1 beta; Tif1b; Tif1beta; TIF1-beta; Transcription intermediary factor 1-beta; transcriptional intermediary factor 1, beta; transcriptional intermediary factor 1-beta; Trim28; tripartite motif; tripartite motif containing 28; tripartite motif protein 28; tripartite motif-containing 28; tripartite motif-containing protein 28
• Common Name: TRIM28
• Gene Symbol: TRIM28
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining