Invitrogen™ Human TRIM27 (aa 136-231) Control Fragment Recombinant Protein

Product Code. 30180826

Brand: Invitrogen™ RP99567

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nuclear matrix. It interacts with the enhancer of polycomb protein and represses gene transcription. It is also thought to be involved in the differentiation of male germ cells. Fusion of the N-terminus of this protein with the truncated C-terminus of the RET gene product has been shown to result in production of the ret transforming protein.

Specifications

• Accession Number: P14373
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5987
• Name: Human TRIM27 (aa 136-231) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW538890; Gm19403; ret finger protein; ret finger protein 1; RFP; RFP transforming protein; Rfp1; RING finger protein 76; RING-type E3 ubiquitin transferase TRIM27; RNF76; Trim27; tripartite motif containing 27; tripartite motif protein 27; tripartite motif protein TRIM27; tripartite motif-containing 27; tripartite motif-containing protein 27; Zinc finger protein RFP
• Common Name: TRIM27
• Gene Symbol: TRIM27
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining