missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207552

Invitrogen™ Human TRIM23 Control Fragment Recombinant Protein

Product Code. 30207552
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207552

Brand: Invitrogen™ RP96831

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58853 (PA5-58853. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as an E3 ubiquitin-protein ligase. In the presence of the human cytomegalovirus (HCMV) protein UL144, participates in 'Lys-63'-linked auto-ubiquitination of TRAF6 resulting in the virally controlled activation of NF-kappa-B at early time of infection. The C-terminus can act as an allosteric activator of the cholera toxin catalytic subunit.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P36406
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 373
Name Human TRIM23 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330516O20Rik; ADP-ribosylation factor domain protein 1; ADP-ribosylation factor domain protein 1 64 kD; ADP-ribosylation factor domain protein 1, 64 kD; ADP-ribosylation factor domain protein 1, 64 kDa; ADP-ribosylation factor domain-containing protein 1; AI450195; ARD1; Ard-1; ARF domain protein 1; ARFD1; E3 ubiquitin-protein ligase TRIM23; GTP-binding protein ARD-1; nucleotide binding protein; RING finger protein 46; RING-type E3 ubiquitin transferase TRIM23; RNF46; TRIM23; tripartite motif containing 23; tripartite motif protein 23; tripartite motif protein TRIM23; tripartite motif-containing 23; tripartite motif-containing protein 23
Common Name TRIM23
Gene Symbol TRIM23
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.