Invitrogen™ Human TRIM22 (aa 134-280) Control Fragment Recombinant Protein

Product Code. 30211388

Brand: Invitrogen™ RP102255

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51964 (PA5-51964. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRIM22 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. It localizes to the cytoplasm and its expression is induced by interferon. The protein down-regulates transcription from the HIV-1 LTR promoter region, suggesting that function of this protein may be to mediate interferon's antiviral effects. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the cytoplasm and its expression is induced by interferon. The protein down-regulates transcription from the HIV-1 LTR promoter region, suggesting that function of this protein may be to mediate interferon's antiviral effects.

Specifications

• Accession Number: Q8IYM9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10346
• Name: Human TRIM22 (aa 134-280) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 50 kDa-stimulated trans-acting factor; E3 ubiquitin-protein ligase TRIM22; GPSTAF50; RING finger protein 94; RING-type E3 ubiquitin transferase TRIM22; RNF94; STAF50; Staf-50; stimulated trans-acting factor (50 kDa); TRIM22; tripartite binding motif 22; tripartite motif containing 22; tripartite motif protein TRIM22; tripartite motif-containing 22; tripartite motif-containing protein 22
• Common Name: TRIM22
• Gene Symbol: TRIM22
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining