Invitrogen™ Human TRIF Control Fragment Recombinant Protein

Product Code. 30210076

Brand: Invitrogen™ RP110086

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in innate immunity against invading pathogens. Adapter used by TLR3 and TLR4 (through TICAM2) to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TRIF recruitment through its TIR domain. Distinct protein-interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively.

Specifications

• Accession Number: Q8IUC6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 148022
• Name: Human TRIF Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW046014; AW547018; hCG_39321; HSD34; IIAE6; MyD88-3; Proline-rich, vinculin and TIR domain-containing protein B; PRVTIRB; Putative NF-kappa-B-activating protein 502 H; RNF36; TI; Ticam1; TICAM-1; TIR domain containing adaptor inducing interferon-beta; TIR domain-containing adapter molecule 1; TIR domain-containing adapter protein inducing IFN-beta; TIR domain-containing adaptor inducing interferon-beta; TIR-domain containing adaptor inducing interferon-beta; toll like receptor adaptor molecule 1; toll-interleukin 1 receptor domain-containing adapter protein inducing interferon-beta; toll-interleukin I receptor domain containing adaptor molecule 1; toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta; toll-like receptor adaptor molecule 1; TRIF
• Common Name: TRIF
• Gene Symbol: TICAM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLDKHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining