missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRIB3 Control Fragment Recombinant Protein

Product Code. 30204789
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204789

Brand: Invitrogen™ RP106634

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A novel inhibitor of cell division, Tribbles, blocks mitosis at a critical point in Drosophila morphogenesis. Recently, mammalian homologues of Tribbles (Trbs) have been identified that control mitogen-activated protein kinase (MAPK) activity. TRIB3 also known as TRB-3, SINK, and SKIP3 is a member of Trbs family. Overexpression of this protein inhibits NF-kB-dependent transcription induced by tumor necrosis factor (TNF) stimulation or its downstream signaling proteins but does not inhibit NF-kB translocation to the nucleus and binding to DNA. TRIB3/SKIP3 is also overexpressed in multiple human tumors and is regulated by hypoxia.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96RU7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57761
Name Human TRIB3 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C20orf97; DJ1103G7.3; Ifld2; induced in fatty liver dystrophy 2; kinase; Neuronal cell death Inducible Putative Kinase; neuronal cell death-inducible putative kinase; Nipk; p65-interacting inhibitor of NF-kappaB; p65-interacting inhibitor of NF-kappa-B; SINK; SKIP3; Trb3; TRB-3; TRIB3; Tribbles 3; Tribbles homolog 3; tribbles homolog 3 (Drosophila); tribbles pseudokinase 3
Common Name TRIB3
Gene Symbol TRIB3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.