Invitrogen™ Human TRIB3 Control Fragment Recombinant Protein

Product Code. 30204789

Brand: Invitrogen™ RP106634

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A novel inhibitor of cell division, Tribbles, blocks mitosis at a critical point in Drosophila morphogenesis. Recently, mammalian homologues of Tribbles (Trbs) have been identified that control mitogen-activated protein kinase (MAPK) activity. TRIB3 also known as TRB-3, SINK, and SKIP3 is a member of Trbs family. Overexpression of this protein inhibits NF-kB-dependent transcription induced by tumor necrosis factor (TNF) stimulation or its downstream signaling proteins but does not inhibit NF-kB translocation to the nucleus and binding to DNA. TRIB3/SKIP3 is also overexpressed in multiple human tumors and is regulated by hypoxia.

Specifications

• Accession Number: Q96RU7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57761
• Name: Human TRIB3 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C20orf97; DJ1103G7.3; Ifld2; induced in fatty liver dystrophy 2; kinase; Neuronal cell death Inducible Putative Kinase; neuronal cell death-inducible putative kinase; Nipk; p65-interacting inhibitor of NF-kappaB; p65-interacting inhibitor of NF-kappa-B; SINK; SKIP3; Trb3; TRB-3; TRIB3; Tribbles 3; Tribbles homolog 3; tribbles homolog 3 (Drosophila); tribbles pseudokinase 3
• Common Name: TRIB3
• Gene Symbol: TRIB3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining