Invitrogen™ Human TRIAP1 (aa 6-70) Control Fragment Recombinant Protein

Product Code. 30209853

Brand: Invitrogen™ RP92082

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62821 (PA5-62821. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis.

Specifications

• Accession Number: O43715
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51499
• Name: Human TRIAP1 (aa 6-70) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 15E1.1; 1810015M01Rik; AU020874; AU043831; HSPC132; MDM35; mitochondrial distribution and morphology 35 homolog; P53CSV; p53-inducible cell-survival factor; Protein 15E1.1; TP53 regulated inhibitor of apoptosis 1; TP53-regulated inhibitor of apoptosis 1; Triap1; WF-1
• Common Name: TRIAP1
• Gene Symbol: TRIAP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining