missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRHR (aa 217-266) Control Fragment Recombinant Protein

Product Code. 30209228
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30209228

missing translation for 'mfr': Invitrogen™ RP108407

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRH-R is a 398 amino acid integral membrane protein with six transmembrane domains and belongs to G-protein coupled receptor 1 family. It acts as a receptor for the signaling hormone TRH and activates the inositol phospholipid-calcium-protein kinase C transduction pathway upon binding with TRH. Reports suggest that TRH-R is a neurotransmitter and neuro regulator that controls dimerization of the TRH receptor and potentiates hormone-induced receptor trafficking. It is known to widely express in the thyrotroph cells of the anterior pituitary.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P34981
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7201
Name Human TRHR (aa 217-266) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias MGC141920; Thyroliberin receptor; thyrotropin releasing hormone receptor; thyrotropin-releasing hormone receptor; TRH receptor; TRH1 Receptor; Trhr; TRH-R; TRH-R1
Common Name TRHR
Gene Symbol TRHR
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.