Invitrogen™ Human TRHR (aa 217-266) Control Fragment Recombinant Protein

Product Code. 30209228

Brand: Invitrogen™ RP108407

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRH-R is a 398 amino acid integral membrane protein with six transmembrane domains and belongs to G-protein coupled receptor 1 family. It acts as a receptor for the signaling hormone TRH and activates the inositol phospholipid-calcium-protein kinase C transduction pathway upon binding with TRH. Reports suggest that TRH-R is a neurotransmitter and neuro regulator that controls dimerization of the TRH receptor and potentiates hormone-induced receptor trafficking. It is known to widely express in the thyrotroph cells of the anterior pituitary.

Specifications

• Accession Number: P34981
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7201
• Name: Human TRHR (aa 217-266) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: MGC141920; Thyroliberin receptor; thyrotropin releasing hormone receptor; thyrotropin-releasing hormone receptor; TRH receptor; TRH1 Receptor; Trhr; TRH-R; TRH-R1
• Common Name: TRHR
• Gene Symbol: TRHR
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining