Invitrogen™ Human TRH (aa 111-169) Control Fragment Recombinant Protein

Product Code. 30196878

Brand: Invitrogen™ RP96454

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57331 (PA5-57331. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism.

Specifications

• Accession Number: P20396
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7200
• Name: Human TRH (aa 111-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Prothyroliberin; Pro-thyrotropin-releasing hormone; protirelin; Pro-TRH; THR; Thyroliberin; thyrotropin releasing hormone; thyrotropin-releasing factor; Thyrotropin-releasing hormone; TRF; Trh; TRH01; TSH-releasing factor
• Common Name: TRH
• Gene Symbol: TRH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining