Invitrogen™ Human TREML4 (aa 8-65) Control Fragment Recombinant Protein

Product Code. 30197150

Brand: Invitrogen™ RP103583

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64198 (PA5-64198. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Positively regulates Toll-like receptor TLR7 signaling in macrophages.

Specifications

• Accession Number: Q6UXN2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 285852
• Name: Human TREML4 (aa 8-65) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5031403H21Rik; BB137214; IDCP1; IG-like domain containing protein IDCP1c; TLT4; TLT-4; TREM; TREM like transcript 4; Treml3; Treml4; trem-like transcript 4 protein; Triggering receptor expressed on myeloid cells; triggering receptor expressed on myeloid cells like 4; triggering receptor expressed on myeloid cells-like 3; triggering receptor expressed on myeloid cells-like 3 b; triggering receptor expressed on myeloid cells-like 4; triggering receptor expressed on myeloid cells-like protein 3; Triggering receptor expressed on myeloid cells-like protein 4; UNQ9425/PRO34675
• Common Name: TREML4
• Gene Symbol: TREML4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining