Invitrogen™ Human TREF1 (aa 719-834) Control Fragment Recombinant Protein

Product Code. 30209744

Brand: Invitrogen™ RP105780

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TREF1 encodes a zinc-finger transcriptional regulating protein which interacts with CBP/p300 to regulate the human gene CYP11A1.

Specifications

• Accession Number: Q96PN7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55809
• Name: Human TREF1 (aa 719-834) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9430096I18Rik; AI429294; B830015H24; BCAR2; Breast cancer anti-estrogen resistance 2; dJ139D8.5; HSA277276; RAPA; rapa-1; rapa-2; RP1-139D8.5; transcriptional regulating factor 1; transcriptional regulating protein 132; transcriptional-regulating factor 1; Transcriptional-regulating protein 132; Trep132; Trep-132; TRERF1; Zinc finger protein rapa; zinc finger transcription factor TReP-132
• Common Name: TREF1
• Gene Symbol: TRERF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QGSGLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGPGEQTVDVEPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining