Invitrogen™ Human TRBP1 (aa 739-836) Control Fragment Recombinant Protein

Product Code. 30211825

Brand: Invitrogen™ RP91765

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55130 (PA5-55130. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The human trans-activation response (TAR) RNA binding protein 1 (TRBP1) was initially identified as a protein that binds to the HIV-1 TAR RNA and activates the long terminal repeat (LTR) expression in the absence and presence of the viral trans-activator Tat. This binding is enhanced by the presence of co-factors such as elongation factor 1-a (EF-1-a), polypyrimidine tract-binding protein (PTB), and the chaperonin-like protein stimulator of TAR RNA-binding proteins (SRB). TRBP1 may act to disengage RNA polymerase II from TAR during transcriptional elongation if the RNA polymerase stalls at the TAR during transcriptional elongation.

Specifications

• Accession Number: Q13395
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6894
• Name: Human TRBP1 (aa 739-836) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Gm17296; Gm179; predicted gene, 17296; probable methyltransferase TARBP1; RP5-827C21.5; TAR (HIV) RNA binding protein 1; TAR (HIV) RNA-binding protein 1; TAR (HIV-1) RNA binding protein 1; TAR RNA loop binding protein; TAR RNA-binding protein 1; TAR RNA-binding protein of 185 kDa; Tarbp1; TRM3; tRNA methyltransferase 3 homolog; TRP185; TRP-185
• Common Name: TRBP1
• Gene Symbol: TARBP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MNELNSVSDLDRCHLYLMVLTELINLHLKVGWKRGNPIWRVISLLKNASIQHLQEMDSGQEPTVGSQIQRVVSMAALAMVCEAIDQKPELQLDSLHAG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining