Invitrogen™ Human TRBP (aa 135-207) Control Fragment Recombinant Protein

Product Code. 30196380

Brand: Invitrogen™ RP104214

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84500 (PA5-84500. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRBP belongs to the family of dsRNA-binding proteins. It consists of highly conserved 2 dsRNA-binding domains and C-terminal basic region. It is a unique cellular protein capable of binding to HIV-TAR RNA and stimulates expression of HIV-1 long terminal repeats. It also inhibits the host antiviral and anti-proliferative mechanisms by directly binding to IFN-regulated dsRNA-dependent protein kinase (PKR). TRBP associates with Ago2 protein and forms an integral component of Dicer-containing complex. It has a role in micro RNA processing and in RISC assembly. Other functions of TRBP include promoting cellular growth and tumorigenesis.

Specifications

• Accession Number: Q15633
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6895
• Name: Human TRBP (aa 135-207) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: fj51e12; HAMAP-Rule:MF_03034}; LOQS; Prbp; PRM-1 RNA-binding protein; protamine-1 RNA-binding protein; RISC-loading complex subunit tarbp2; RISC-loading complex subunit TARBP2 {ECO:0000255; TAR (HIV) RNA binding protein 2; TAR (HIV) RNA-binding protein 2; TAR (HIV) RNA-binding protein TRBP1; TAR (HIV-1) RNA binding protein 2; TAR RNA binding protein 2; TAR RNA-binding protein 2; TARBP2; TARBP2 subunit of RISC loading complex; TARBP2, RISC loading complex RNA binding subunit; trans-activation responsive RNA-binding protein; trans-activation-responsive RNA-binding protein; TRBP; TRBP1; TRBP2; wu:fj51e12; zgc:63778
• Common Name: TRBP
• Gene Symbol: TARBP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining