Invitrogen™ Human TRAPPC8 Control Fragment Recombinant Protein

Product Code. 30180560

Brand: Invitrogen™ RP98246

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59429 (PA5-59429. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9Y2L5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22878
• Name: Human TRAPPC8 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: general sporulation gene 1 homolog; GSG1; HsT2706; KIAA1012; Protein TRS85 homolog; trafficking protein particle complex 8; trafficking protein particle complex subunit 8; TRAPPC8; TRS85
• Common Name: TRAPPC8
• Gene Symbol: TRAPPC8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DYDLNISATTPWFESYRETFLQSMPASDHEFLNHYLACMLVASSSEAEPVEQFSKLSQEQHRIQHNSDYSYPKWFIPNTLKYYVLLHDVSAGDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining