Invitrogen™ Human TRAPPC4 (aa 4-75) Control Fragment Recombinant Protein

Product Code. 30201891

Brand: Invitrogen™ RP97553

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83475 (PA5-83475. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRAPPC4 is part of the multisubunit TRAPP (transport protein particle) complex and interacts with SDC2. It may play a role in vesicular transport from endoplasmic reticulum to Golgi. TRAPP proteins are involved in tethering during vesicle transport.

Specifications

• Accession Number: Q9Y296
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51399
• Name: Human TRAPPC4 (aa 4-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500017G03Rik; AI303617; CGI-104; Hematopoietic stem/progenitor cell protein 172; HSPC172; hypothetical protein LOC504391; PTD009; Sbd; Sbdn; Sdcbp2; synbindin; syndecan binding protein 2; trafficking protein particle complex 4; trafficking protein particle complex subunit 4; Trappc4; TRS23; TRS23 homolog; zgc:73260
• Common Name: TRAPPC4
• Gene Symbol: Trappc4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining