Invitrogen™ Human TRAP alpha (aa 230-286) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30204182	100 μL	100µL

Product Code. 30204182 Supplier Invitrogen™ Supplier No. RP90181

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52811 (PA5-52811. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are exclusively non-canonical.

Specifications

• Accession Number: P43307
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6745
• Name: Human TRAP alpha (aa 230-286) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2510001K09Rik; 6330400D04; Ac2-238; AI159733; AI452176; cb758; DKFZp781N23103; liver regeneration-related protein LRRG137; PGP35; PSEC0262; signal sequence receptor subunit 1; signal sequence receptor subunit alpha; signal sequence receptor, alpha; signal sequence receptor, alpha (translocon-associated protein alpha); SSR; SSR alpha subunit; SSR1; SSRA precursor protein; SSR-alpha; translocon associated protein alpha; translocon-associated protein alpha; translocon-associated protein alpha subunit; translocon-associated protein subunit alpha; TRAP alpha; TRAPA; TRAP-alpha; unnamed protein product
• Common Name: TRAP alpha
• Gene Symbol: SSR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining