missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRAP alpha (aa 230-286) Control Fragment Recombinant Protein

Product Code. 30204182
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30204182 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204182 Supplier Invitrogen™ Supplier No. RP90181

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52811 (PA5-52811. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are exclusively non-canonical.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P43307
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6745
Name Human TRAP alpha (aa 230-286) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2510001K09Rik; 6330400D04; Ac2-238; AI159733; AI452176; cb758; DKFZp781N23103; liver regeneration-related protein LRRG137; PGP35; PSEC0262; signal sequence receptor subunit 1; signal sequence receptor subunit alpha; signal sequence receptor, alpha; signal sequence receptor, alpha (translocon-associated protein alpha); SSR; SSR alpha subunit; SSR1; SSRA precursor protein; SSR-alpha; translocon associated protein alpha; translocon-associated protein alpha; translocon-associated protein alpha subunit; translocon-associated protein subunit alpha; TRAP alpha; TRAPA; TRAP-alpha; unnamed protein product
Common Name TRAP alpha
Gene Symbol SSR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.