Invitrogen™ Human Transferrin (aa 52-168) Control Fragment Recombinant Protein

Product Code. 30195955

Brand: Invitrogen™ RP100504

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transferrins (Tf) are an approximately 80kDa blood plasma glycoprotein synthesized by the liver. They are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Transferrin is the primary blood iron transport protein and under normal conditions; approximately one-third of total blood transferrin contains bound iron. Measurement of blood transferrin levels can be used as an indicator for blood iron-carrying capacity and abnormalities of iron metabolism such as anaemia, iron overload and haemochromatosis.Serum transferrin may also have a further role in stimulating cell proliferation.

Specifications

• Accession Number: P02787
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7018
• Name: Human Transferrin (aa 52-168) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI266983; beta-1 metal-binding globulin; Cd176; DKFZp781D0156; epididymis secretory sperm binding protein Li 71 p; HEL-S-71 p; HP; hpx; hypotransferrinemia with hemochromatosis; ICA; Inhibitor of carbonic anhydrase; lactoferrin; liver regeneration-related protein LRRG03; liver transferrin; LOC100146633; PICA; porcine inhibitor of carbonic anhydrase; porcine inhibitor of carbonic anhydrase precursor; PRO1400; PRO1557; PRO2086; Serotransferrin; siderophilin; TF; Tfn; TFQTL1; transferin; Transferrin; transferrin precursor; Trf
• Common Name: Transferrin
• Gene Symbol: Tf
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining