missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRAF6 (aa 289-373) Control Fragment Recombinant Protein

Product Code. 30206260
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206260

Brand: Invitrogen™ RP92877

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tumor necrosis factor (TNF) receptor associated factors (TRAFs) were initially discovered as adaptor proteins that link the TNF receptor superfamily to signaling pathways and are thus important regulators of cell death and cellular response to stress. TRAF proteins share a homology region that allows them to bind to cell receptors and other TRAF proteins, causing the activation of different signal cascades depending on the TRAFs involved. For example, TRAF2 and TRAF3 directly bind to the CD40, a NF receptor superfamily member involved in inducing B cell immunity, and are critical for NF-kappa-B activation in mouse B lymphocytes. TRAF2 along with TRAF6 has also been shown to be required for CD40 signaling in nonhemopoietic cells. TRAF2 also interacts with the TRFR superfamily member lymphotoxin-beta receptor (LTbetaR) in association with TRAF3 and the apoptosis inhibitors cIAP1 and Smac.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y4K3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7189
Name Human TRAF6 (aa 289-373) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310003F17Rik; AI851288; C630032O20Rik; E3 ubiquitin-protein ligase TRAF6; interleukin-1 signal transducer; MGC:3310; RING finger protein 85; RING-type E3 ubiquitin transferase TRAF6; RNF85; TNF receptor associated factor 6; TNF receptor-associated factor 6; TNF receptor-associated factor 6, E3 ubiquitin protein ligase; Traf6
Common Name TRAF6
Gene Symbol TRAF6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.