Invitrogen™ Human TRAF5 Control Fragment Recombinant Protein

Product Code. 30202980

Brand: Invitrogen™ RP89647

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52507 (PA5-52507. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tumor necrosis factor (TNF) induced signaling is mediated through association of TNF receptor (TNFR) with adaptor proteins, such as TNF receptor associated proteins (TRAFs). TRAFs form a family of cytoplasmic adapter proteins that mediate signal transduction from many members of the TNF-receptor superfamily (e. g. RANK, CD30, CD40, etc. ) and the interleukin-1 receptor. The carboxy-terminal region of TRAFs is required for self-association and interaction with receptor cytoplasmic domains following ligand-induced oligomerization. Recent molecular cloning studies have lead to identification of six TRAFs (TRAF1-TRAF6) (1-4). TRAF5 is a 558-amino acid protein. TRAF5 is implicated in NF-kB and c-Jun NH(2)-terminal kinase/stress-activated protein kinase activation by members of the TNF receptor superfamily, including CD27, CD30, CD40, and lymphotoxin-beta receptor. Targeted disruption of TRAF5 gene causes defects in CD40-CD27 mediated lymphocyte activation (5).

Specifications

• Accession Number: O00463
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7188
• Name: Human TRAF5 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700049M22Rik; AI875481; AU022477; BH3 interacting domain death agonist; BH3-interacting domain death agonist; BH3-interacting domain death agonist p11; BH3-interacting domain death agonist p13; BH3-interacting domain death agonist p15; BID; MGC:39780; p11 BID; p13 BID; p15 BID; p22 BID; RING finger protein 84; RNF84; TNF receptor associated factor 5; TNF receptor-associated factor 5; Traf5
• Common Name: TRAF5
• Gene Symbol: TRAF5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NAKVILGRYQQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining