Invitrogen™ Human TRAC-1 (aa 60-142) Control Fragment Recombinant Protein

Product Code. 30181499

Brand: Invitrogen™ RP98228

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59607 (PA5-59607. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRAC-1 is a 232 amino acid protein containing an N-terminal RING-type zinc finger domain. It functions as a positive regulator in the T-cell receptor signaling pathway, thus leading to T-cell activation. It mediates ubiquitination and subsequent proteasomal degradation of target proteins. TRAC-1 is expressed in lymphoid tissues, including bone marrow, spleen, thymus as well as in other tissues. It is predominantly expressed in the CD4+ and CD8+ T-cells, suggesting that it is preferentially confined to T-cells.

Specifications

• Accession Number: Q96EQ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54941
• Name: Human TRAC-1 (aa 60-142) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930553F04Rik; E3 ubiquitin-protein ligase RNF125; RING finger protein 125; ring finger protein 125, E3 ubiquitin protein ligase; RNF125; T-cell RING activation protein 1; T-cell ring protein identified in activation screen; TNORS; TRAC1; TRAC-1
• Common Name: TRAC-1
• Gene Symbol: RNF125
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining