Invitrogen™ Human TRA2A (aa 2-37) Control Fragment Recombinant Protein

Product Code. 30209584

Brand: Invitrogen™ RP101428

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62897 (PA5-62897. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRA2A (Transformer 2 alpha) is a member of the transformer 2 homolog family and encodes a protein with two RS domains and an RRM (RNA recognition motif) domain. It is a sequence specific RNA binding protein which participates in the regulation of pre-mRNA splicing.

Specifications

• Accession Number: Q13595
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29896
• Name: Human TRA2A (aa 2-37) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500010G04Rik; AL022798; AWMS1; G430041M01Rik; HSU53209; htra-2 alpha; htra-2-alpha; mAWMS1; nuclear transformer-2 alpha; putative MAPK activating protein PM24; RGD1562563; TRA-2 alpha; TRA2A; Tra2alpha; TRA2-alpha; transformer 2 alpha homolog; transformer 2 alpha homolog (Drosophila); transformer-2 alpha; transformer-2 protein homolog A; Transformer-2 protein homolog alpha
• Common Name: TRA2A
• Gene Symbol: TRA2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining