Invitrogen™ Human TPRG1L (aa 41-106) Control Fragment Recombinant Protein

Product Code. 30205902

Brand: Invitrogen™ RP107217

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66562 (PA5-66562. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Presynaptic protein involved in the synaptic transmission tuning. Regulates synaptic release probability by decreasing the calcium sensitivity of release.

Specifications

• Accession Number: Q5T0D9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 127262
• Name: Human TPRG1L (aa 41-106) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200015A19Rik; Fam79a; family with sequence similarity 79, member A; h-mover; mossy fiber terminal-associated vertebrate-specific presynaptic protein; mossy-fiber terminal-associated vertebrate-specific presynaptic protein; Mover; Protein FAM79A; RP11-46F15.3; Svap30; synaptic vesicle associated protein of 30 kD; Tprg1l; Tprgl; transformation related protein 63 regulated like; tumor protein p63 regulated 1-like; tumor protein p63-regulated gene 1-like protein
• Common Name: TPRG1L
• Gene Symbol: TPRG1L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining