missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TPR (aa 1105-1194) Control Fragment Recombinant Protein

Product Code. 30212984
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30212984

Marque: Invitrogen™ RP91828

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54048 (PA5-54048. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Steroidogenic factor-1 (SF-1) regulates multiple genes involved in the adrenal and gonadal development and in the biosynthesis of a variety of hormones, including adrenal and gonadal steroids, anti-Mullerian hormone (AMH), and gonadotropins. SF-1 belongs to the fushi tarazu factor-1 (FTZ-F1) subfamily of orphan nuclear receptors. In the adult ovary, SF-1 localizes to theca/interstitial cells.
TRUSTED_SUSTAINABILITY

Spécification

Accession Number P12270
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7175
Name Human TPR (aa 1105-1194) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610029M07Rik; C77892; Megator; NPC-associated intranuclear protein; nuclear pore complex-associated protein Tpr; nucleoprotein TPR; nucleoprotein TPR-like protein; Tpr; translocated promoter region (to activated MET oncogene); translocated promoter region and nuclear basket protein; Translocated promoter region protein; translocated promoter region, nuclear basket protein; tumor potentiating region
Common Name TPR
Gene Symbol TPR
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KMASVRQHLEETTQKAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis